PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G403300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 273aa    MW: 29372.3 Da    PI: 9.2227
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G403300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Sevir.5G403300.1.p 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                        79******************************99************97 PP

2Myb_DNA-binding56.18.4e-1867111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg++T e+del+++++++lG++ W++Ia  ++ gRt++++k++w+++
  Sevir.5G403300.1.p  67 RGNFTDEDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                         89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.243961IPR017930Myb domain
SuperFamilySSF466892.48E-2913108IPR009057Homeodomain-like
SMARTSM007174.1E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001671.14E-111661No hitNo description
PROSITE profilePS5129428.23862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2765116IPR009057Homeodomain-like
SMARTSM007179.8E-1766114IPR001005SANT/Myb domain
PfamPF002499.7E-1667111IPR001005SANT/Myb domain
CDDcd001671.34E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDEDDELIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPQTHRPLS GGSAAAAASG LTTSSTAGFP SPPPAPRPAR PAITIPPNAM FARPAPSEDG  180
HSSSGGSSDA PRCPDLNLDL DLSVGPPCSP PKTPAAAATT PTSQQQQQQQ QQRATICLCY  240
HLGVRGGEAC SCKTASPAGF RFLRPLEEGQ YI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997320.0FP099732.1 Phyllostachys edulis cDNA clone: bphylf047p14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456719.10.0hypothetical protein SORBIDRAFT_03g041360
SwissprotP813935e-98MYB08_ANTMA; Myb-related protein 308
TrEMBLC5XRB40.0C5XRB4_SORBI; Putative uncharacterized protein Sb03g041360
STRINGSb03g041360.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-86myb domain protein 4